PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.012G106100.1
Common NamePOPTR_0012s10790g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family ARF
Protein Properties Length: 855aa    MW: 94869.2 Da    PI: 6.6476
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.012G106100.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B373.92e-23156257199
                         EEEE-..-HHHHTT-EE--HHH.HTT......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE- CS
                  B3   1 ffkvltpsdvlksgrlvlpkkfaeeh......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkld 85 
                         f+k+lt sd++++g +++ +++a+e+      + + + +++l+ +d++g +W++++i+r++++r++l++GW+ Fv++++L +gD ++F   
  Potri.012G106100.1 156 FCKTLTASDTSTHGGFSVLRRHADEClppldmSRQ-PPTQELVAKDLHGSEWRFRHIFRGQPRRHLLQSGWSVFVSSKRLVAGDAFIFL-- 243
                         99*****************************7333.34459************************************************.. PP

                         SSSEE..EEEEE-S CS
                  B3  86 grsefelvvkvfrk 99 
                         + +++el+v+v+r+
  Potri.012G106100.1 244 RGENGELRVGVRRA 257
                         449999*****996 PP

2Auxin_resp121.37.1e-40282364183
          Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                         a+ha+st+++F+v+Y+Pr+s++eF+v+++++++++k+++s+GmRfkm+fe+e+++e+r++Gt+vg++d+dp+rW++SkWr+Lk
  Potri.012G106100.1 282 AWHAVSTGTMFTVYYKPRTSPAEFIVPFDQYMESVKSNYSIGMRFKMRFEGEEAPEQRFTGTIVGIEDADPSRWKDSKWRCLK 364
                         89*******************************************************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019362.49E-40152285IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.102.2E-41153271IPR015300DNA-binding pseudobarrel domain
CDDcd100172.55E-21154256No hitNo description
SMARTSM010196.4E-23156258IPR003340B3 DNA binding domain
PROSITE profilePS5086311.942156258IPR003340B3 DNA binding domain
PfamPF023622.4E-21156257IPR003340B3 DNA binding domain
PfamPF065074.9E-37282364IPR010525Auxin response factor
PfamPF023091.1E-10718812IPR033389AUX/IAA domain
SuperFamilySSF542775.89E-12723805No hitNo description
PROSITE profilePS5174524.592728812IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008285Biological Processnegative regulation of cell proliferation
GO:0009734Biological Processauxin-activated signaling pathway
GO:0009737Biological Processresponse to abscisic acid
GO:0009911Biological Processpositive regulation of flower development
GO:0010047Biological Processfruit dehiscence
GO:0010150Biological Processleaf senescence
GO:0010227Biological Processfloral organ abscission
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0048481Biological Processplant ovule development
GO:0005634Cellular Componentnucleus
GO:0005515Molecular Functionprotein binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 855 aa     Download sequence    Send to blast
MASSEISAKA NSGNIKGGGE SFSSGYSEAM EGQKGHSTHP SSARDAETAL YNELWHACAG  60
PLVTVPREGD HVFYFPQGHL EQVEASTNQV ADQQMPLYDL PPKILCRVVN VQLKAEPDTD  120
EVFAQVTLLP LHNQDENASE KEPPPPPPPR FHVHSFCKTL TASDTSTHGG FSVLRRHADE  180
CLPPLDMSRQ PPTQELVAKD LHGSEWRFRH IFRGQPRRHL LQSGWSVFVS SKRLVAGDAF  240
IFLRGENGEL RVGVRRAMRQ QSNVPSSVIS SHSMHLGVLA TAWHAVSTGT MFTVYYKPRT  300
SPAEFIVPFD QYMESVKSNY SIGMRFKMRF EGEEAPEQRF TGTIVGIEDA DPSRWKDSKW  360
RCLKVRWDET STIPRPDRVS PWKIEPALAP PALNPLPMPR PKRPRANMVP SSPDSSVLTR  420
EGSSKVTADP SSASGFSRVL RGQEFSTLRG NFEEGNESDV AEKSVLWPPS ADDEKIDVLS  480
SSRRFGSEWW ISSARQEPTY TDLLSGFGAN ADSSHGFGAP FVDQTAGGAN PMKKHLSDQG  540
QFNLLASPWS IMSPGLSLKL SESNSRVPIQ GSSDVTYQSR ENIRYSAFSE YPMLHGLRVE  600
QSHGNCMMPP PPSHFDNHAH TRELIPKPKL VQEHNTGKSL DGNCKLFGIP LKISKPATPE  660
QAGQTNMVNE PMGHTQPASH QLTSESDQKS EHSRGSKLAD ENENEKPLQV GHMRMRDSHG  720
KAQNSSTRSC TKVHKQGIAL GRSVDLTRFN NYDELIAELD RLFEFNGELL APQKNWLIVY  780
TDDEDDMMLV GDDPWQEFVG MVRKIVIYTR EEVQRIKPGT LNSRVNENPS GVEGEDAKEA  840
KHLPLPSASS PLSC*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldw_B1e-1784938618354Auxin response factor 1
4ldw_A1e-1784938618354Auxin response factor 1
4ldv_A1e-1784938618354Auxin response factor 1
4ldx_B1e-1784938618354Auxin response factor 1
4ldx_A1e-1784938618354Auxin response factor 1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pth.104110.0bud
Functional Description ? help Back to Top
Source Description
UniProtAuxin response factors (ARFs) are transcriptional factors that binds specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs). {ECO:0000256|RuleBase:RU004561}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00574DAPTransfer from AT5G62000Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002318767.10.0auxin response factor 2 family protein
SwissprotQ94JM30.0ARFB_ARATH; Auxin response factor 2
TrEMBLB9I3Y90.0B9I3Y9_POPTR; Auxin response factor
STRINGPOPTR_0012s10790.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF32813366
Representative plantOGRP5501582
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G62000.30.0auxin response factor 2